PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim04g077210.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family TALE
Protein Properties Length: 356aa    MW: 40093.8 Da    PI: 6.2373
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim04g077210.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.3e-092823162155
                         HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
            Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                         k +yps++e+  LA+++gL+++q+ +WF N+R ++
  Sopim04g077210.0.1 282 KWPYPSESEKVALAESTGLDQKQINNWFINQRKRH 316
                         669*****************************885 PP

2ELK383.6e-13236257122
                 ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                         ELK++LlrKYsgyL+sLkqE+s
  Sopim04g077210.0.1 236 ELKNHLLRKYSGYLSSLKQELS 257
                         9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012558.8E-2192136IPR005540KNOX1
PfamPF037903.0E-2293135IPR005540KNOX1
SMARTSM012566.2E-26143194IPR005541KNOX2
PfamPF037911.1E-23147192IPR005541KNOX2
SMARTSM011883.5E-7236257IPR005539ELK domain
PfamPF037892.5E-10236257IPR005539ELK domain
PROSITE profilePS5121311.296236256IPR005539ELK domain
PROSITE profilePS5007112.762256319IPR001356Homeobox domain
SuperFamilySSF466892.35E-19257331IPR009057Homeodomain-like
SMARTSM003891.3E-12258323IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.4E-27261322IPR009057Homeodomain-like
CDDcd000863.69E-12268320No hitNo description
PfamPF059201.0E-16276315IPR008422Homeobox KN domain
PROSITE patternPS000270294317IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001708Biological Processcell fate specification
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010089Biological Processxylem development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MENNNYNNHV SGENSGGQRG HFFYGGNQVL GGAAPIYGRG GDCYDPMIVK TEGGGSTSHH  60
NHTFHYPSII RNHHHDSTET SGGGAGAGEV IEALKAKIIA HPQCSNLLDA YMDCQKVGAP  120
PEVAARLSAV RQEFEARQRA SLTDRDVSKD PELDQFMEAY YDMLVKYREE LTRPLQEAME  180
FMQKIEAQLN MLGNAPVRIF NSEDKCEGVG SSEEDQDNSG GETELPEIDP RAEDRELKNH  240
LLRKYSGYLS SLKQELSKKK KKGKLPKDAR QKLITWWELH YKWPYPSESE KVALAESTGL  300
DQKQINNWFI NQRKRHWKPS EDMQFMVMDG LHPQSAAALY MEGHYMGEGP FRLGQ*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00675ChIP-seqTransfer from GRMZM2G017087Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLEU322470.0U32247.1 Lycopersicon esculentum Knotted 1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001233807.20.0homeotic protein knotted-1
SwissprotQ413300.0KN1_SOLLC; Homeotic protein knotted-1
TrEMBLK4BUF80.0K4BUF8_SOLLC; Uncharacterized protein
STRINGSolyc04g077210.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49732333
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-136KNOTTED-like from Arabidopsis thaliana